missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BNIP1 Full-length ORF (AAH10959, 1 a.a. - 228 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000662-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132321

  • 3343.96 SEK / 10µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq]

Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
Specifications

Specifications

AAH10959
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
50.82kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
BNIP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
662
BNIP1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NIP1/SEC20/TRG-8
BNIP1
Yes
Videos
SDS
Documents
Certificates