missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BOLA3 Full-length ORF (AAH42036.1, 1 a.a. - 68 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00388962-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16180504

  • 3343.96 SEK / 10µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIE
Specifications

Specifications

AAH42036.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.8kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
BOLA3
Yes
wheat germ expression system
Liquid
388962
BOLA3 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BOLA3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates