missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BRSK2 Full-length ORF (AAH24291.1, 1 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human BRSK2 Full-length ORF (AAH24291.1, 1 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16133192
Price: 4515.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00009024-P01.10ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16133192

4515.00 SEK / 10µg

Estimated Shipment: 07-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Descrizione

Sequence: MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL

Specifica

Accession Number	AAH24291.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	44.9kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Regulatory Status	RUO
Common Name	BRSK2
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	9024
Name	BRSK2 (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	C11orf7/FLJ41362/PEN11B/SAD1/STK29
Gene Symbol	BRSK2
Recombinant	Recombinant
Expression System	wheat germ expression system

Suggerimenti di prodotto

Abnova™ Human BRSK2 Full-length ORF (AAH24291.1, 1 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal

Descrizione

Specifica

Suggerimenti di prodotto

Documenti

Offerte speciali