missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BUB1B Partial ORF (AAH18739, 1 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000701-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132391

  • 3343.96 SEK / 10µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq]

Sequence: MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
Specifications

Specifications

AAH18739
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
39.93kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
RUO
BUB1B
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
701
BUB1B (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BUB1beta/BUBR1/Bub1A/MAD3L/SSK1/hBUBR1
BUB1B
Yes
Videos
SDS
Documents
Certificates