missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human C1orf22 Full-length ORF (AAH16464.1, 1 a.a. - 122 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4055.00 SEK - 6150.00 SEK

Specifications

Name C1orf22 (Human) Recombinant Protein (P01)
Recombinant Yes
Purification Method Glutathione Sepharose 4 Fast Flow
For Use With (Application) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Molecular Weight 39.9kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16124893
View Documents Promotion Details
Abnova™
H00080267-P01.25UG
25 ug
6150.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 04-08-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16114893
View Documents Promotion Details
Abnova™
H00080267-P01.10UG
10 ug
4055.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 04-08-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Quality control in the endoplasmic reticulum (ER) ensures that only properly folded proteins are retained in the cell through recognition and degradation of misfolded or unassembled proteins. EDEM3 belongs to a group of proteins that accelerate degradation of misfolded glycoproteins in the ER (Hirao et al., 2006 [PubMed 16431915]).[supplied by OMIM]

Sequence: MGGFKYGDEQPRSDWRSYRRNLEHAVLELTLFKTVPSKMEIHSSPFKCSTAPPCNTSGQGKITEHSCEPDFCCLWIDKKQNSFSSGVGNRSLDSLLIKGSSPFLVLGVRGSFGKMHPSIVAF
Specifications

Specifications

C1orf22 (Human) Recombinant Protein (P01)
Glutathione Sepharose 4 Fast Flow
39.9kDa
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SDS
Product Certifications