missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human C1orf22 Full-length ORF (AAH16464.1, 1 a.a. - 122 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00080267-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16114893

  • 4055.00 SEK / 10µg
Estimated Shipment: 29-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Quality control in the endoplasmic reticulum (ER) ensures that only properly folded proteins are retained in the cell through recognition and degradation of misfolded or unassembled proteins. EDEM3 belongs to a group of proteins that accelerate degradation of misfolded glycoproteins in the ER (Hirao et al., 2006 [PubMed 16431915]).[supplied by OMIM]

Sequence: MGGFKYGDEQPRSDWRSYRRNLEHAVLELTLFKTVPSKMEIHSSPFKCSTAPPCNTSGQGKITEHSCEPDFCCLWIDKKQNSFSSGVGNRSLDSLLIKGSSPFLVLGVRGSFGKMHPSIVAF
Specifications

Specifications

AAH16464.1
Liquid
80267
C1orf22 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MGGFKYGDEQPRSDWRSYRRNLEHAVLELTLFKTVPSKMEIHSSPFKCSTAPPCNTSGQGKITEHSCEPDFCCLWIDKKQNSFSSGVGNRSLDSLLIKGSSPFLVLGVRGSFGKMHPSIVAF
RUO
EDEM3
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
39.9kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C1orf22
EDEM3
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers