Learn More
Abnova™ Human CA5A Full-length ORF (NP_001730.1, 1 a.a. - 305 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4515.00 SEK - 6845.00 SEK
Specifications
Accession Number | NP_001730.1 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 763 |
Molecular Weight (g/mol) | 61.2kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16172491
|
Abnova™
H00000763-P01.25UG |
25 ug |
6845.00 SEK
25µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16162491
|
Abnova™
H00000763-P01.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. [provided by RefSeq]
Sequence: MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRSSpecifications
NP_001730.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
61.2kDa | |
Glutathione Sepharose 4 Fast Flow | |
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS | |
RUO | |
CA5A | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, Protein Array, ELISA, Western Blot | |
763 | |
CA5A (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CA5/CAV/CAVA | |
CA5A | |
Recombinant | |
wheat germ expression system |