missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CALCR Partial ORF (NP_001733.1, 394 a.a. - 474 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000799-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16063705

  • 3234.00 SEK / 10µg


Estimated Shipment
09-02-2021
Add to basket

Description

Description

This gene encodes a high affinity receptor for the peptide hormone calcitonin and belongs to a subfamily of seven transmembrane-spanning G protein-coupled receptors. The encoded protein is involved in maintaining calcium homeostasis and in regulating osteoclast-mediated bone resorption. Polymorphisms in this gene have been associated with variations in bone mineral density and onset of osteoporosis. Alternate splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
Specifications

Specifications

NP_001733.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.65kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA
RUO
CALCR
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
799
CALCR (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CRT|CTR|CTR1
CALCR
Yes
Videos
SDS
Documents