missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CALN1 Partial ORF (NP_113656.1, 36 a.a. - 106 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00083698-Q03.10ug
Additional Details : Weight : 0.02000kg
Description
This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq]
Sequence: EELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSpecifications
| AAH20200 | |
| Liquid | |
| 83698 | |
| CALN1 (Human) Recombinant Protein (Q03) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CALN1 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.55kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| EELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLV | |
| RUO | |
| CALN1 | |
| Yes | |
| wheat germ expression system |