missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CAPN7 Partial ORF (NP_055111.1, 714 a.a. - 813 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023473-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16184726

  • 5030.41 SEK / 25µg

Estimated Shipment: 24-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The function of the protein encoded by this gene is not known. An orthologue has been found in mouse but it seems to diverge from other family members. The mouse orthologue is thought to be calcium independent with protease activity. [provided by RefSeq]

Sequence: NPIYQFHIEKTGPLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSGDYRCGFCYLELENIPSGIFNIIPSTFLPKQEGPFFLDFNSIIPIKITQLQ
Specifications

Specifications

NP_055111.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NPIYQFHIEKTGPLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSGDYRCGFCYLELENIPSGIFNIIPSTFLPKQEGPFFLDFNSIIPIKITQLQ
RUO
CAPN7
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
23473
CAPN7 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CALPAIN7/FLJ36423/PALBH
CAPN7
Yes
Videos
SDS
Documents
Certificates