missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CAPNS1 Partial ORF (AAH00592, 172 a.a. - 260 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000826-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132591

  • 3343.96 SEK / 10µg

Estimated Shipment: 25-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Sequence: KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
Specifications

Specifications

AAH00592
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.42kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
RUO
CAPNS1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
826
CAPNS1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
30K/CALPAIN4/CANP/CANPS/CAPN4/CDPS
CAPNS1
Yes
Videos
SDS
Documents
Certificates