missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CAPZB Partial ORF (NP_004921, 192 a.a. - 272 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000832-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135644

  • 5030.41 SEK / 25µg

Estimated Shipment: 19-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq]

Sequence: SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
Specifications

Specifications

NP_004921
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.65kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
RUO
CAPZB
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
832
CAPZB (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CAPB/CAPPB/CAPZ/MGC104401/MGC129749/MGC129750
CAPZB
Yes
Videos
SDS
Documents
Certificates