missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CASP3 Partial ORF (NP_004337, 176 a.a. - 277 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000836-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16063715

  • 3234.00 SEK / 10µg


Estimated Shipment
05-02-2021
Add to basket

Description

Description

Sequence: SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Specifications

Specifications

AAH16926.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.96kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
RUO
CASP3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
836
CASP3 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CPP32|CPP32B|SCA-1
CASP3
Yes
Videos
SDS
Documents