missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human CD155 (aa 28-129) Control Fragment Recombinant Protein

Produktkod. 30196266
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30196266 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30196266 Leverantör Invitrogen™ Leverantörsnummer RP89976

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82463 (PA5-82463. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P15151
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5817
Namn Human CD155 (aa 28-129) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 3830421F03Rik; AI325026; AI987993; CD112; CD155; D7Ertd458e; FLJ25946; herpes virus entry mediator B; Herpesvirus entry mediator B; hveB; HVED; mE4; mHveB; Mph; murine herpes virus entry protein B; murine herpesvirus entry protein B; NECL5; necl-5; Nectin cell adhesion molecule 2; Nectin2; Nectin-2; nectin-like 5; nectin-like protein 5; Poliovirus receptor; poliovirus receptor homolog; poliovirus receptor-related 2; poliovirus receptor-related protein 2; poliovirus sensitivity; PVR; Pvrl2; PVS; sCD112; soluble CD112; Taa1; TAGE4; tumor-associated antigen 1; tumor-associated glycoprotein pE4
Vanligt namn CD155
Gensymbol PVR
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.