missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196011

Invitrogen™ Human CD177 Control Fragment Recombinant Protein

Product Code. 30196011
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy
This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD177 (NB1/HNA-2a and PRV-1 form) is a GPI-anchored glycoprotein present mainly on neutrophils. Its plasma membrane expression is increased during pregnancy and and inflammation or after G-CSF application. Ligand of CD177 has been identified as CD31 (PECAM-1). CD177 participates in neutrophil transmigration and seems to be also a pro-proliferative molecule. The antibodies against CD177 can be involved in neonatal alloimmune neutropenia (NAN).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N6Q3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57126
Name Human CD177 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1190003K14Rik; CD177; CD177 antigen; CD177 molecule; cell surface receptor; HNA2A; HNA-2 A; Human neutrophil alloantigen 2 A; NB1; NB1 glycoprotein; NB1 GP; Pdp3; Polycythemia rubra vera protein 1; PRV1; PRV-1; RGD1562941; UNQ595/PRO1181
Common Name CD177
Gene Symbol CD177
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GATHCYDGYIHLSGGGLTTRMSIQGCVAQPSSSLLNHTRQIGIFSVCEKGDEPPPASQHEGGG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.