missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDC6 Partial ORF (NP_001245, 434 a.a. - 533 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000990-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132951

  • 5030.41 SEK / 25µg

Estimated Shipment: 25-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc6, a protein essential for the initiation of DNA replication. This protein functions as a regulator at the early steps of DNA replication. It localizes in cell nucleus during cell cyle G1, but translocates to the cytoplasm at the start of S phase. The subcellular translocation of this protein during cell cyle is regulated through its phosphorylation by Cdks. Transcription of this protein was reported to be regulated in response to mitogenic signals through transcriptional control mechanism involving E2F proteins. [provided by RefSeq]

Sequence: ISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVF
Specifications

Specifications

NP_001245
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVF
RUO
CDC6
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
990
CDC6 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CDC18L/HsCDC18/HsCDC6
CDC6
Yes
Videos
SDS
Documents
Certificates