missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDH11 Partial ORF (NP_001788, 509 a.a. - 617 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001009-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132991

  • 3343.96 SEK / 10µg

Estimated Shipment: 19-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Expression of this particular cadherin in osteoblastic cell lines, and its upregulation during differentiation, suggests a specific function in bone development and maintenance. [provided by RefSeq]

Sequence: PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST
Specifications

Specifications

NP_001788
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST
RUO
CDH11
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1009
CDH11 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CAD11/CDHOB/OB/OSF-4
CDH11
Yes
Videos
SDS
Documents
Certificates