missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDH2 Partial ORF (NP_001783, 807 a.a. - 906 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4515.00 SEK - 6845.00 SEK

Specifications

Accession Number NP_001783
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 1000
Molecular Weight (g/mol) 36.74kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16013815
View Documents Promotion Details
Abnova™
H00001000-Q01.25UG
25 ug
6845.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 05-04-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16003815
View Documents Promotion Details
Abnova™
H00001000-Q01.10UG
10 ug
4515.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 05-04-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. The protein functions during gastrulation and is required for establishment of left-right asymmetry. At certain central nervous system synapses, presynaptic to postsynaptic adhesion is mediated at least in part by this gene product. [provided by RefSeq]

Sequence: RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Specifications

Specifications

NP_001783
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD325/CDHN/CDw325/NCAD
CDH2
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
1000
CDH2 (Human) Recombinant Protein (Q01)
RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
RUO
CDH2
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications