missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human CDK11A (aa 688-765) Control Fragment Recombinant Protein

Produktkod. 30207755
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30207755 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30207755 Leverantör Invitrogen™ Leverantörsnummer RP105663

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84929 (PA5-84929. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PITSLRE beta1 protein, a distantly related member of the Cdk family of protein kinases, induces apoptosis after low levels of ectopic expression. Apoptosis, or programmed cell death, is similarly induced by ectopic expression of an amino terminal deletion mutant retaining the catalytic and carboxyterminal domains of PITSLRE beta1, but not by other mutants lacking Histone H1 kinase activity or by other Cdk family members. The terminology for the ten isoforms of the PITSLRE subfamily of proteins is based on the conserved PSTAIRE box region of Cdc2 p34. Depending on which of the PITSLRE genes produce the protein, the cDNA and protein are designated alpha, beta or gamma (i.e., PITSLRE A gene, alpha; PITSLRE B gene, beta and PITSLRE C gene, gamma). Some of the isoforms such as PITSLRE alpha1 (T cells) and PITSLRE beta1 (B cells and brain), are expressed in specific cell types, while others are expressed ubiquitously.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q9UQ88
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 728642
Namn Human CDK11A (aa 688-765) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias CDC2L2; CDC2L3; CDK11 p110; CDK11 p46; CDK11 p58; CDK11A; CDK11-p110; CDK11-p46; CDK11-p58; cell division cycle 2-like 2 (PITSLRE proteins); cell division cycle 2-like protein kinase 2; Cell division protein kinase 11 A; cyclin dependent kinase 11 A; cyclin-dependent kinase 11 A; Galactosyltransferase-associated protein kinase p58/GTA; p58GTA; PITSLRE; PITSLRE B; PITSLRE protein kinase beta; PITSLRE serine/threonine-protein kinase CDC2L2; PITSLREB
Vanligt namn CDK11A
Gensymbol CDK11A
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens MNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHL
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.