missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDKL3 Partial ORF (AAH41799.1, 322 a.a. - 420 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051265-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16055505

  • 4865.00 SEK / 25µg


Estimated Shipment
04-02-2021
Add to basket

Description

Description

Sequence: NELRKDERKTVYTNTLLSSSVLGKEIEKEKKPKEIKVRVIKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKLVTIEPPNPINPSTNCNGLKE
Specifications

Specifications

AAH41799.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NELRKDERKTVYTNTLLSSSVLGKEIEKEKKPKEIKVRVIKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKLVTIEPPNPINPSTNCNGLKE
RUO
CDKL3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
51265
CDKL3 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NKIAMRE
CDKL3
Yes
Videos
SDS
Documents