missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CEACAM6 Partial ORF (NP_002474.3, 156 a.a. - 265 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004680-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16121675

  • 5854.80 SEK / 25µg
Estimated Shipment: 07-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Carcinoembryonic antigen (CEA; MIM 114890) is one of the most widely used tumor markers in serum immunoassay determinations of carcinoma. An apparent lack of absolute cancer specificity for CEA probably results in part from the presence in normal and neoplastic tissues of antigens that share antigenic determinants with the 180-kD form of CEA (Barnett et al., 1988 [PubMed 3220478]). For background information on the CEA family of genes, see CEACAM1 (MIM 109770).[supplied by OMIM]

Sequence: PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNP
Specifications

Specifications

NP_002474.3
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNP
RUO
CEACAM6
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4680
CEACAM6 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD66c/CEAL/NCA
CEACAM6
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers