missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CENTG3 Partial ORF (NP_114152, 241 a.a. - 338 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00116988-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16181547

  • 5030.41 SEK / 25µg

Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: VFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNI
Specifications

Specifications

NP_114152
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNI
RUO
AGAP3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
116988
CENTG3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CENTG3/CRAG/FLJ16146/MRIP-1
AGAP3
Yes
Videos
SDS
Documents
Certificates