missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CGB2 Partial ORF (NP_203696, 1 a.a. - 56 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00114336-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161387

  • 4055.00 SEK / 10µg
Estimated Shipment: 27-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone beta (LHB) subunit gene. The CGB genes are primarily distinguished by differences in the 5' untranscribed region. This gene was originally thought to be one of the two pseudogenes (CGB1 and CGB2) of CGB subunit, however, detection of CGB1 and CGB2 transcripts in vivo, and their presence on the polysomes, suggested that these transcripts are translated. To date, a protein product corresponding to CGB2 has not been isolated. The deduced sequence of the hypothetical protein of 132 aa does not share any similarity with that of functional CGB subunits (PMID:8954017). However, a 163 aa protein, translated from a different frame, is about the same size, and shares 98% identity with other CGB subunits. [provided by RefSeq]

Sequence: MSTSPVLAEDIPLRERHVKGAAAVAAAEHGRDMGIQGAASATVPPHQCHPGCGEGG
Specifications

Specifications

NP_203696
Liquid
114336
CGB2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CGB2
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.9kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MSTSPVLAEDIPLRERHVKGAAAVAAAEHGRDMGIQGAASATVPPHQCHPGCGEGG
RUO
CGB2
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers