missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CLCN6 Partial ORF (NP_001277.1, 770 a.a. - 868 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001185-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136404

  • 5030.41 SEK / 25µg

Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB. [provided by RefSeq]

Sequence: PRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGEIVGIITRHNLTYEFLQARLRQHYQT
Specifications

Specifications

NP_001277.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGEIVGIITRHNLTYEFLQARLRQHYQT
RUO
CLCN6
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1185
CLCN6 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CLC-6/KIAA0046
CLCN6
Yes
Videos
SDS
Documents
Certificates