missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CLGN Partial ORF (NP_004353.1, 21 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001047-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16063825

  • 4865.00 SEK / 25µg


Estimated Shipment
10-02-2021
Add to basket

Description

Description

Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneisis and infertility. [provided by RefSeq]

Sequence: FMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHH
Specifications

Specifications

NP_004353.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHH
RUO
CLGN
Yes
wheat germ expression system
Liquid
1047
CLGN (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CLGN
Wheat Germ (in vitro)
GST
Videos
SDS
Documents