missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CNTN2 Partial ORF (NP_005067, 825 a.a. - 923 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006900-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136285

  • 3343.96 SEK / 10µg

Estimated Shipment: 19-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. It may also be involved in glial tumorigenesis and may provide a potential target for therapeutic intervention. [provided by RefSeq]

Sequence: SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTF
Specifications

Specifications

NP_005067
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTF
RUO
CNTN2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6900
CNTN2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AXT/DKFZp781D102/FLJ42746/MGC157722/TAG-1/TAX/TAX1
CNTN2
Yes
Videos
SDS
Documents
Certificates