missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COL9A3 Partial ORF (NP_001844, 280 a.a. - 338 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001299-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136524

  • 3343.96 SEK / 10µg

Estimated Shipment: 30-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia. [provided by RefSeq]

Sequence: GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGL
Specifications

Specifications

NP_001844
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.23kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGL
RUO
COL9A3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1299
COL9A3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DJ885L7.4.1/EDM3/FLJ90759/IDD/MED
COL9A3
Yes
Videos
SDS
Documents
Certificates