missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COLEC11 Full-length ORF (NP_076932.1, 1 a.a. - 271 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00078989-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16183973

  • 3343.96 SEK / 10µg

Estimated Shipment: 22-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

COLEC11 is a member of the collectin family of C-type lectins, which contain a collagen-like domain and a carbohydrate recognition domain, and play a role in host-defense (Keshi et al., 2006 [PubMed 17179669]).[supplied by OMIM]

Sequence: MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Specifications

Specifications

NP_076932.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
55.1kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CL-K1-I/CL-K1-II/CL-K1-IIa/CL-K1-IIb/CLK1/DKFZp686N1868/MGC3279
COLEC11
Yes
wheat germ expression system
Liquid
78989
COLEC11 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
RUO
COLEC11
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates