missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CORO1C Partial ORF (NP_055140, 375 a.a. - 473 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023603-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16124896

  • 3860.70 SEK / 10µg
Estimated Shipment: 07-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [provided by RefSeq]

Sequence: EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA
Specifications

Specifications

NP_055140
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA
RUO
CORO1C
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
23603
CORO1C (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HCRNN4
CORO1C
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers