missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COX6B2 Full-length ORF (NP_653214.2, 1 a.a. - 88 a.a.) Recombinant Protein with GST-tag at N-terminal

Liquid

4055.00 SEK - 6150.00 SEK

Specifications

Name COX6B2 (Human) Recombinant Protein (P02)
Recombinant Yes
Purification Method Glutathione Sepharose 4 Fast Flow
For Use With (Application) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Molecular Weight 35.42kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16117693
View Documents Promotion Details
Abnova™
H00125965-P02.25UG
25 ug
6150.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 28-07-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16107693
View Documents Promotion Details
Abnova™
H00125965-P02.10UG
10 ug
4055.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 28-07-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI
Specifications

Specifications

COX6B2 (Human) Recombinant Protein (P02)
Glutathione Sepharose 4 Fast Flow
35.42kDa
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SDS
Product Certifications