missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CPSF2 Partial ORF (NP_059133, 683 a.a. - 782 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00053981-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137466

  • 3343.96 SEK / 10µg

Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: FGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYAIV
Specifications

Specifications

NP_059133
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYAIV
RUO
CPSF2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
53981
CPSF2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CPSF100/KIAA1367
CPSF2
Yes
Videos
SDS
Documents
Certificates