missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CREB3L4 Partial ORF (NP_570968, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00148327-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16162077

  • 4055.00 SEK / 10µg
Estimated Shipment: 28-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

cAMP response element-binding (CREB) proteins are a family of mammalian transcription activators. For further background information on CREB proteins, see CREB1 (MIM 123810).[supplied by OMIM]

Sequence: MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSP
Specifications

Specifications

NP_570968
Liquid
148327
CREB3L4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AIBZIP/ATCE1/CREB3/CREB4/JAL/hJAL
CREB3L4
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSP
RUO
CREB3L4
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers