missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CRELD1 Partial ORF (NP_056328.2, 245 a.a. - 344 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00078987-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16179866

  • 5030.41 SEK / 25µg

Estimated Shipment: 30-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Epidermal growth factor (EGF; MIM 131530)-like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.[supplied by OMIM]

Sequence: DIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICV
Specifications

Specifications

NP_056328.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICV
RUO
CRELD1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
78987
CRELD1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AVSD2/CIRRIN/DKFZp566D213
CRELD1
Yes
Videos
SDS
Documents
Certificates