missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human CRISPLD2 (aa 23-76) Control Fragment Recombinant Protein

Produktkod. 30204391
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30204391 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30204391 Leverantör Invitrogen™ Leverantörsnummer RP109797

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145108 (PA5-145108. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CRISPLD2 promotes matrix assembly.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q9H0B8
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 83716
Namn Human CRISPLD2 (aa 23-76) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 1810049K24Rik; coffeecrisp; CRISP11; CRISP-11; CRISPLD2; cysteine rich secretory protein LCCL domain containing 2; cysteine-rich secretory protein 11; cysteine-rich secretory protein LCCL domain containing 2; cysteine-rich secretory protein LCCL domain-containing 2; late gestation lung protein 1; LCCL domain containing cysteine-rich secretory protein 2; LCCL domain-containing cysteine-rich secretory protein 2; Lcrisp2; Lgl1; testis secretory sperm-binding protein Li 207 A; trypsin inhibitor; UNQ2914/PRO1156/PRO9783
Vanligt namn CRISPLD2
Gensymbol CRISPLD2
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens YLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQVQPQASN
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.