Learn More
Abnova™ Human CRYAA Full-length ORF (NP_000385.1, 1 a.a. - 173 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00001409-P01.25ug
Additional Details : Weight : 0.00010kg
Description
Crystallins are separated into 2 classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes major pr. of vertebrate eye lens and maintains transparency and refractive index of lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into a, b, and g families; b and g crystallins are considered as a superfamily. a and b families are further divided into acidic and basic groups. 7 protein regions exist in crystallins: 4 homologous motifs, a connecting peptide, and N- and C-terminal extensions. a crystallins are composed of 2 gene products: a-A and a-B, for acidic and basic, respectively. a crystallins can be induced by heat shock and are members of the sHSP (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in fashion of a true chaperone instead they hold them in large soluble aggregates. Post-translational modifications decrease ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the a-A and a-B subunits have a 3:1 ratio, resp. Two additional functions of a crystallins are an autokinase activity and participation in intracellular architecture. a-A and a-B gene products are differentially expressed a-A is preferentially restricted to lens and a-B is expressed widely in many tissues and organs. Defects in this gene cause ADCC.
Sequence: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSSSpecifications
NP_000385.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
46.3kDa | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CRYA1/HSPB4 | |
CRYAA | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
1409 | |
CRYAA (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS | |
RUO | |
CRYAA | |
Wheat Germ (in vitro) | |
GST | |
Liquid |