Läs mer
Abnova™ Human CTNNB1 Partial ORF (AAH58926, 682 a.a. - 781 a.a.) Recombinant Protein with GST-tag at N-terminal
Beskrivning
Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the 'contact inhibition' signal, which instructs cells to stop dividing once an epithelial sheet is complete.[supplied by OMIM]
Specifikationer
Specifikationer
Tillträdesnummer | AAH58926 |
För användning med (applikation) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 1499 |
Molekylvikt (g/mol) | 36.74kDa |
Namn | CTNNB1 (Human) Recombinant Protein (Q01) |
Kvalitetskontrolltestning | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Kvantitet | 10 ug |
Immunogen | LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL |
Förvaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Visa mer |
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.