missing translation for 'onlineSavingsMsg'
Läs mer
Abnova™ Human CTNNB1 Partial ORF (AAH58926, 682 a.a. - 781 a.a.) Recombinant Protein with GST-tag at N-terminal Produktkod.: 16173721

Abnova™ Human CTNNB1 Partial ORF (AAH58926, 682 a.a. - 781 a.a.) Recombinant Protein with GST-tag at N-terminal

Produktkod. 16173721
10 ug
Klicka för att se tillgängliga alternativ
Kvantitet:
10 ug
25 ug
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 16173721

Brand: Abnova™ H00001499Q01.10ug

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Used for AP, Array, ELISA, WB-Re

Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the 'contact inhibition' signal, which instructs cells to stop dividing once an epithelial sheet is complete.[supplied by OMIM]

Sequence: LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Specifikationer

Tillträdesnummer AAH58926
För användning med (applikation) Antibody Production, ELISA, Protein Array, Western Blot
Formulering 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 1499
Molekylvikt (g/mol) 36.74kDa
Namn CTNNB1 (Human) Recombinant Protein (Q01)
Kvalitetskontrolltestning 12.5% SDS-PAGE Stained with Coomassie Blue.
Kvantitet 10 ug
Immunogen LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Förvaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatorisk status RUO
Gene Alias CTNNB/DKFZp686D02253/FLJ25606/FLJ37923
Vanligt namn CTNNB1
Gensymbol CTNNB1
Art Wheat Germ (in vitro)
Rekombinant Recombinant
Protein Tag GST
Uttryckssystem wheat germ expression system
Form Liquid
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel
Abnova™ Human CTNNB1 Partial ORF (AAH58926, 682 a.a. - 781 a.a.) Recombinant Protein with GST-tag at N-terminal >

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.