missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CTRC Partial ORF (NP_009203.2, 170 a.a. - 268 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00011330-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16114096

  • 4055.00 SEK / 10µg
Estimated Shipment: 30-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. [provided by RefSeq]

Sequence: ADKLQQGLQPVVDHATCSRIDWWGFRVKKTMVCAGGDGVISACNGDSGGPLNCQLENGSWEVFGIVSFGSRRGCNTRKKPVVYTRVSAYIDWINEKMQL
Specifications

Specifications

NP_009203.2
Liquid
11330
CTRC (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CLCR/ELA4
CTRC
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ADKLQQGLQPVVDHATCSRIDWWGFRVKKTMVCAGGDGVISACNGDSGGPLNCQLENGSWEVFGIVSFGSRRGCNTRKKPVVYTRVSAYIDWINEKMQL
RUO
CTRC
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers