missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CUL3 Partial ORF (AAH39598, 301 a.a. - 400 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008452-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
CUL3 is a component of a ubiquitin E3 ligase that is essential for mitotic division (Sumara et al., 2007 [PubMed 17543862]).[supplied by OMIM]
Sequence: KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVSpecifications
| AAH39598 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.41kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGV | |
| RUO | |
| CUL3 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 8452 | |
| CUL3 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CUL3 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |