missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CYP11A1 Partial ORF (AAH32329, 412 a.a. - 521 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001583-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16183851

  • 5030.41 SEK / 25µg

Estimated Shipment: 19-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide. [provided by RefSeq]

Sequence: KTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ
Specifications

Specifications

AAH32329
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.95kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ
RUO
CYP11A1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1583
CYP11A1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CYP11A/P450SCC
CYP11A1
Yes
Videos
SDS
Documents
Certificates