missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CYP26C1 Partial ORF (NP_899230.2, 423 a.a. - 522 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00340665-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132827

  • 5030.41 SEK / 25µg

Estimated Shipment: 22-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme is involved in the catabolism of all-trans- and 9-cis-retinoic acid, and thus contributes to the regulation of retinoic acid levels in cells and tissues. This gene is adjacent to a related gene on chromosome 10q23.33. [provided by RefSeq]

Sequence: SPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARWELATPAFPAMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL
Specifications

Specifications

NP_899230.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARWELATPAFPAMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL
RUO
CYP26C1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
340665
CYP26C1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ45301
CYP26C1
Yes
Videos
SDS
Documents
Certificates