missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DIRAS2 Partial ORF (NP_060064, 81 a.a. - 180 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00054769-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137736

  • 5030.41 SEK / 25µg

Estimated Shipment: 09-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

DIRAS2 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM]

Sequence: AFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG
Specifications

Specifications

NP_060064
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG
RUO
DIRAS2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
54769
DIRAS2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp761C07121/Di-Ras2
DIRAS2
Yes
Videos
SDS
Documents
Certificates