Läs mer
Abnova™ Human DLG5 Partial ORF (NP_004738, 1708 a.a. - 1809 a.a.) Recombinant Protein with GST-tag at N-terminal
Beskrivning
This gene encodes a member of the family of discs large (DLG) homologs, a subset of the membrane-associated guanylate kinase (MAGUK) superfamily. The MAGUK proteins are composed of a catalytically inactive guanylate kinase domain, in addition to PDZ and SH3 domains, and are thought to function as scaffolding molecules at sites of cell-cell contact. The protein encoded by this gene localizes to the plasma membrane and cytoplasm, and interacts with components of adherens junctions and the cytoskeleton. It is proposed to function in the transmission of extracellular signals to the cytoskeleton and in the maintenance of epithelial cell structure. Alternative splice variants have been described but their biological nature has not been determined. [provided by RefSeq]
Specifikationer
Specifikationer
| Tillträdesnummer | NP_004738 |
| För användning med (applikation) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 9231 |
| Molekylvikt (g/mol) | 36.96kDa |
| Namn | DLG5 (Human) Recombinant Protein (Q01) |
| Kvalitetskontrolltestning | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Kvantitet | 10 μg |
| Immunogen | LDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL |
| Förvaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Visa mer |
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.