missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DMRTA1 Partial ORF (NP_071443, 301 a.a. - 390 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00063951-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Sequence: ESGNESEWVKDLTSTKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILRFCKGDVVQAIEQVLNGKEHKPDNRNLANSEELENTAFQRASpecifications
NP_071443 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.64kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
ESGNESEWVKDLTSTKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILRFCKGDVVQAIEQVLNGKEHKPDNRNLANSEELENTAFQRA | |
RUO | |
DMRTA1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
63951 | |
DMRTA1 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DMO/MGC163307/MGC163309 | |
DMRTA1 | |
Recombinant | |
wheat germ expression system |