missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30200588

Invitrogen™ Human DOK4 (aa 204-316) Control Fragment Recombinant Protein

Produktkod. 30200588
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30200588 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30200588 Leverantör Invitrogen™ Leverantörsnummer RP108710
 Begränsad artikel
Beräknad leverans: 02-11-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK4 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway. Putative link with downstream effectors of RET in neuronal differentiation. May be involved in the regulation of the immune response induced by T-cells. [UniProt].
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q8TEW6
Koncentration ≥5.0 mg/mL
För användning med (applikation) Neutralization, Control
Formulering PBS, 1M urea with no preservative; pH 7.4
Gen-ID (Entrez) 55715
Namn Human DOK4 (aa 204-316) Control Fragment
pH-intervall 7.4
Reningsmetod Purified
Kvantitet 100 μL
Förvaringskrav -20°C, Avoid Freeze/Thaw Cycles
Regulatorisk status RUO
Gene Alias docking protein 4; Dok4; Downstream of tyrosine kinase 4; insulin receptor substrate 5; IRS5; IRS-5
Vanligt namn DOK4
Gensymbol DOK4
Produkttyp Protein
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens AGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLEMEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQG
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.