missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DPH2 Partial ORF (NP_001375, 125 a.a. - 235 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001802-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16177304

  • 5030.41 SEK / 25µg

Estimated Shipment: 08-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: RQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLS
Specifications

Specifications

NP_001375
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.95kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLS
RUO
DPH2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1802
DPH2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DPH2L2
DPH2
Yes
Videos
SDS
Documents
Certificates