missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EDG1 Partial ORF (AAH18650, 1 a.a. - 47 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001901-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16184331

  • 5030.41 SEK / 25µg

Estimated Shipment: 08-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq]

Sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL
Specifications

Specifications

AAH18650
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
30.91kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL
RUO
S1PR1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1901
EDG1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CHEDG1/D1S3362/ECGF1/EDG-1/EDG1/FLJ58121/S1P1
S1PR1
Yes
Videos
SDS
Documents
Certificates