missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human EDG1 Partial ORF (AAH18650, 1 a.a. - 47 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00001901-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq]
Sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLSpecifications
| AAH18650 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 30.91kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL | |
| RUO | |
| S1PR1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 1901 | |
| EDG1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CHEDG1/D1S3362/ECGF1/EDG-1/EDG1/FLJ58121/S1P1 | |
| S1PR1 | |
| Recombinant | |
| wheat germ expression system |