missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ELK4 Partial ORF (NP_001964.2, 118 a.a. - 206 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002005-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16177624

  • 3343.96 SEK / 10µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq]

Sequence: KDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAA
Specifications

Specifications

NP_001964.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.53kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAA
RUO
ELK4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2005
ELK4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SAP1
ELK4
Yes
Videos
SDS
Documents
Certificates