missing translation for 'onlineSavingsMsg'
Läs mer

Abnova™ Human EMR4 Partial ORF (XP_377506, 21 a.a. - 93 a.a.) Recombinant Protein with GST-tag at N-terminal

Produktkod. 16122787
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
10 μg
25 μg
Förpackningsstorlek:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16122787 10 μg 10µg
16132787 25 μg 25µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16122787 Leverantör Abnova™ Leverantörsnummer H00326342Q01.10ug

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Used for AP, Array, ELISA, WB-Re

This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq]

Sequence: GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG

Specifikationer

Tillträdesnummer XP_377506
För användning med (applikation) Antibody Production, ELISA, Protein Array, Western Blot
Formulering 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 326342
Molekylvikt (g/mol) 33.77kDa
Namn EMR4 (Human) Recombinant Protein (Q01)
Kvalitetskontrolltestning 12.5% SDS-PAGE Stained with Coomassie Blue.
Kvantitet 10 μg
Immunogen GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
Förvaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatorisk status RUO
Gene Alias EMR4/FIRE/GPR127/PGR16
Vanligt namn EMR4P
Gensymbol EMR4P
Art Wheat Germ (in vitro)
Rekombinant Recombinant
Protein Tag GST
Uttryckssystem wheat germ expression system
Form Liquid
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.