Läs mer
Abnova™ Human EMR4 Partial ORF (XP_377506, 21 a.a. - 93 a.a.) Recombinant Protein with GST-tag at N-terminal
Beskrivning
This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq]
Specifikationer
Specifikationer
| Tillträdesnummer | XP_377506 |
| För användning med (applikation) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 326342 |
| Molekylvikt (g/mol) | 33.77kDa |
| Namn | EMR4 (Human) Recombinant Protein (Q01) |
| Kvalitetskontrolltestning | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Kvantitet | 10 μg |
| Immunogen | GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG |
| Förvaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Visa mer |
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.