missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EMR4 Partial ORF (XP_377506, 21 a.a. - 93 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00326342-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16122787

  • 4055.00 SEK / 10µg
Estimated Shipment: 14-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq]

Sequence: GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
Specifications

Specifications

XP_377506
Liquid
326342
EMR4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EMR4/FIRE/GPR127/PGR16
EMR4P
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.77kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
RUO
EMR4P
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers